Recombinant Corylus avellana 11S globulin-like protein

Catalog Number: CSB-EP2015IQL
Article Name: Recombinant Corylus avellana 11S globulin-like protein
Biozol Catalog Number: CSB-EP2015IQL
Supplier Catalog Number: CSB-EP2015IQL
Alternative Catalog Number: CSB-EP2015IQL-1, CSB-EP2015IQL-100, CSB-EP2015IQL-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 63.7 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q8W1C2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.99.
Source: E.coli
Expression System: 23-515aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: INVGLRRQQQRYFGECNLDRLNALEPTNRIEAEACQIESWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFEDPQQQSQQGQRQGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLLHTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQGEGNNVFSGFDAEFLADAFNVDVDTARRLQSNQDKRRNIVKVE
Application Notes: Research Areas: Others