Recombinant Juglans regia Non-specific lipid-transfer protein

Catalog Number: CSB-EP2029IQJ
Article Name: Recombinant Juglans regia Non-specific lipid-transfer protein
Biozol Catalog Number: CSB-EP2029IQJ
Supplier Catalog Number: CSB-EP2029IQJ
Alternative Catalog Number: CSB-EP2029IQJ-1, CSB-EP2029IQJ-100, CSB-EP2029IQJ-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 16.1 kDa
Tag: C-terminal 6xHis-tagged
UniProt: C5H617
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.96.
Source: E.coli
Expression System: 27-119aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: VITCGQVASSVGSCIGYLRGTVPTVPPSCCNGVKSLNKAAATTADRQAACECLKKTSGSIPGLNPGLAAGLPGKCGVSVPYKISTSTNCKAVK
Application Notes: Research Areas: Others