Recombinant Anacardium occidentale 2s albumin (ana o 3)

Catalog Number: CSB-EP2389IQK
Article Name: Recombinant Anacardium occidentale 2s albumin (ana o 3)
Biozol Catalog Number: CSB-EP2389IQK
Supplier Catalog Number: CSB-EP2389IQK
Alternative Catalog Number: CSB-EP2389IQK-1, CSB-EP2389IQK-100, CSB-EP2389IQK-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 21.2 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q8H2B8
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.98.
Source: E.coli
Expression System: 21-138aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SIYRAIVEVEEDSGREQSCQRQFEEQQRFRNCQRYVKQEVQRGGRYNQRQESLRECCQELQEVDRRCRCQNLEQMVRQLQQQEQIKGEEVRELYETASELPRICSISPSQGCQFQSSY
Application Notes: Research Areas: Others