Recombinant Mycobacterium tuberculosis Antitoxin MT2731 (MT2731)

Catalog Number: CSB-EP300323MVZ
Article Name: Recombinant Mycobacterium tuberculosis Antitoxin MT2731 (MT2731)
Biozol Catalog Number: CSB-EP300323MVZ
Supplier Catalog Number: CSB-EP300323MVZ
Alternative Catalog Number: CSB-EP300323MVZ-1, CSB-EP300323MVZ-100, CSB-EP300323MVZ-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 14.6 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P9WJ10
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-81aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDPP
Application Notes: Research Areas: Others