Recombinant Escherichia coli O6:H1Superoxide dismutase [Fe] (sodB)

Catalog Number: CSB-EP314591FQR
Article Name: Recombinant Escherichia coli O6:H1Superoxide dismutase [Fe] (sodB)
Biozol Catalog Number: CSB-EP314591FQR
Supplier Catalog Number: CSB-EP314591FQR
Alternative Catalog Number: CSB-EP314591FQR-1, CSB-EP314591FQR-100, CSB-EP314591FQR-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: sodB,c2050
Molecular Weight: 28.0 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P0AGD4
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 2-193aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SFELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSSEGGVFNNAAQVWNHTFYWNCLAPNAGGEPTGKVAEAIAASFGSFADFKAQFTDAAIKNFGSGWTWLVKNSDGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPGYLEHFWALVNWEFVAKNLAA
Application Notes: Research Areas: Others. Endotoxin: Not test