Recombinant Escherichia coli Tyrosine--tRNA ligase (tyrS)

Catalog Number: CSB-EP314597ENV
Article Name: Recombinant Escherichia coli Tyrosine--tRNA ligase (tyrS)
Biozol Catalog Number: CSB-EP314597ENV
Supplier Catalog Number: CSB-EP314597ENV
Alternative Catalog Number: CSB-EP314597ENV-1, CSB-EP314597ENV-100, CSB-EP314597ENV-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Tyrosyl-tRNA synthetase
Molecular Weight: 54.3 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P0AGJ9
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.140.
Source: E.coli
Expression System: 2-424aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ASSNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSLHLGHLVPLLCLKRFQQAGHKPVALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCGENSAIAANNYDWFGNMNVLTFLRDIGKHFSVNQMINKEAVKQRLNREDQGISFTEFSYNLLQGYDFACLNKQYGVVLQIGGSDQWGNITSGIDLTRRLHQNQVFGLTVPLITKADGTKFGKTEGGAVWLDPKKTSPYKF
Application Notes: Research Areas: Others