Recombinant Priestia megaterium Bifunctional cytochrome P450/NADPH--P450 reductase (cyp102A1), partial
Catalog Number:
CSB-EP320426FSZ
- Images (0)
| Article Name: | Recombinant Priestia megaterium Bifunctional cytochrome P450/NADPH--P450 reductase (cyp102A1), partial |
| Biozol Catalog Number: | CSB-EP320426FSZ |
| Supplier Catalog Number: | CSB-EP320426FSZ |
| Alternative Catalog Number: | CSB-EP320426FSZ-1, CSB-EP320426FSZ-100, CSB-EP320426FSZ-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (Cytochrome P450(BM-3))(Cytochrome P450BM-3)(Fatty acid monooxygenase)(Flavocytochrome P450 BM3)(Cytochrome P450 102A1)(NADPH--cytochrome P450 reductase) |
| Molecular Weight: | 61.2 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | P14779 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 2-472aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | TIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKFVRDFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKASGEQSDDLLTHMLNGKDPETGEPLDDENIR |
Product Guarantee and Expert Support
