Recombinant Helicobacter pylori Urease subunit alpha (ureA)

Catalog Number: CSB-EP320452HUV
Article Name: Recombinant Helicobacter pylori Urease subunit alpha (ureA)
Biozol Catalog Number: CSB-EP320452HUV
Supplier Catalog Number: CSB-EP320452HUV
Alternative Catalog Number: CSB-EP320452HUV-1, CSB-EP320452HUV-100, CSB-EP320452HUV-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Urea amidohydrolase subunit alpha
Molecular Weight: 30.5 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P14916
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-238aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MKLTPKELDKLMLHYAGELAKKRKEKGIKLNYVEAVALISAHIMEEARAGKKTAAELMQEGRTLLKPDDVMDGVASMIHEVGIEAMFPDGTKLVTVHTPIEANGKLVPGELFLKNEDITINEGKKAVSVKVKNVGDRPVQIGSHFHFFEVNRCLDFDREKTFGKRLDIASGTAVRFEPGEEKSVELIDIGGNRRIFGFNALVDRQADNESKKIALHRAKERGFHGAKSDDNYVKTIKE