Recombinant Cat Beta-lactoglobulin-2 (LGB2)

Catalog Number: CSB-EP322005CA
Article Name: Recombinant Cat Beta-lactoglobulin-2 (LGB2)
Biozol Catalog Number: CSB-EP322005CA
Supplier Catalog Number: CSB-EP322005CA
Alternative Catalog Number: CSB-EP322005CA-1, CSB-EP322005CA-100, CSB-EP322005CA-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Beta-LG-2,Beta-lactoglobulin II
Molecular Weight: 25.5 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P21664
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-163aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ATLPPTMEDLDIRQVAGTWHSMAMAASDISLLDSETAPLRVYVQELRPTPRDNLEIILRKRENHACIEGNIMAQRTEDPAVFMVDYQGEKKISVLDTDYTHYMFFCMEAPAPGTENGMMCQYLARTLKADNEVMEKFDRALQTLPVHIRIILDLTQGKEQCRV
Application Notes: Research Areas: Others. Endotoxin: Not test