Recombinant Escherichia coli Aspartate--tRNA ligase (aspS)

Catalog Number: CSB-EP322043ENV
Article Name: Recombinant Escherichia coli Aspartate--tRNA ligase (aspS)
Biozol Catalog Number: CSB-EP322043ENV
Supplier Catalog Number: CSB-EP322043ENV
Alternative Catalog Number: CSB-EP322043ENV-1, CSB-EP322043ENV-100, CSB-EP322043ENV-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Aspartyl-tRNA synthetase
Molecular Weight: 72.8 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P21889
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.125.
Source: E.coli
Expression System: 1-590aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MRTEYCGQLRLSHVGQQVTLCGWVNRRRDLGSLIFIDMRDREGIVQVFFDPDRADALKLASELRNEFCIQVTGTVRARDEKNINRDMATGEIEVLASSLTIINRADVLPLDSNHVNTEEARLKYRYLDLRRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPMLTKATPEGARDYLVPSRVHKGKFYALPQSPQLFKQLLMMSGFDRYYQIVKCFRDEDLRADRQPEFTQIDVETSFMTAPQVREVMEALVRHL
Application Notes: Research Areas: Others