Recombinant Autographa californica nuclear polyhedrosis virus Major capsid protein (P39)

Catalog Number: CSB-EP322943ARA
Article Name: Recombinant Autographa californica nuclear polyhedrosis virus Major capsid protein (P39)
Biozol Catalog Number: CSB-EP322943ARA
Supplier Catalog Number: CSB-EP322943ARA
Alternative Catalog Number: CSB-EP322943ARA-1, CSB-EP322943ARA-100, CSB-EP322943ARA-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 46.4 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
UniProt: P17499
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-347aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MALVPVGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAYHDDGWFICNNHLIKRFKMSKMVLPIFDEDDNQFKMTIARHLVGNKERGIKRILIPSATNYQDVFNLNSMMQAEQLIFHLIYNNENAVNTICDNLKYTEGFTSNTQRVIHSVYATTKSILDTTNPNTFCSRVSRDELRFFDVTNARALRGGAGDQLFNNYSGFLQNLIRRAVAPEYLQIDTEELRFRNCATCIIDETGLVASVPDGPELYNPIRS
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.