Recombinant Leiurus quinquestriatus hebraeus Alpha-insect toxin LqhaIT

Catalog Number: CSB-EP322958LDS
Article Name: Recombinant Leiurus quinquestriatus hebraeus Alpha-insect toxin LqhaIT
Biozol Catalog Number: CSB-EP322958LDS
Supplier Catalog Number: CSB-EP322958LDS
Alternative Catalog Number: CSB-EP322958LDS-1, CSB-EP322958LDS-100, CSB-EP322958LDS-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Lqh-alpha-IT Short name: Alpha-IT
Molecular Weight: 23.5 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: P17728
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 20-85aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: VRDAYIAKNYNCVYECFRDAYCNELCTKNGASSGYCQWAGKYGNACWCYALPDNVPIRVPGKCHRK