Recombinant Escherichia coli K99 fimbrial protein (fanC)
Catalog Number:
CSB-EP322992ENL
- Images (0)
| Article Name: | Recombinant Escherichia coli K99 fimbrial protein (fanC) |
| Biozol Catalog Number: | CSB-EP322992ENL |
| Supplier Catalog Number: | CSB-EP322992ENL |
| Alternative Catalog Number: | CSB-EP322992ENL-1, CSB-EP322992ENL-100, CSB-EP322992ENL-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | fanCK99 fimbrial protein |
| Molecular Weight: | 32.5 kDa |
| Tag: | N-terminal 6xHis-SUMO-tagged |
| UniProt: | P18103 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 23-181aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTTSASFLVTYM |
Product Guarantee and Expert Support
