Recombinant Escherichia phage T7 Major capsid protein

Catalog Number: CSB-EP323144EEB
Article Name: Recombinant Escherichia phage T7 Major capsid protein
Biozol Catalog Number: CSB-EP323144EEB
Supplier Catalog Number: CSB-EP323144EEB
Alternative Catalog Number: CSB-EP323144EEB-1, CSB-EP323144EEB-100, CSB-EP323144EEB-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Gene product 10A,Major head protein
Molecular Weight: 43.5 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P19726
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.221.
Source: E.coli
Expression System: 1-345aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MASMTGGQQMGTNQGKGVVAAGDKLALFLKVFGGEVLTAFARTSVTTSRHMVRSISSGKSAQFPVLGRTQAAYLAPGENLDDKRKDIKHTEKVITIDGLLTADVLIYDIEDAMNHYDVRSEYTSQLGESLAMAADGAVLAEIAGLCNVESKYNENIEGLGTATVIETTQNKAALTDQVALGKEIIAALTKARAALTKNYVPAADRVFYCDPDSYSAILAALMPNAANYAALIDPEKGSIRNVMGFEVVEVPHLTA
Application Notes: Research Areas: Others