Recombinant Avian sarcoma virus Tyrosine-protein kinase transforming protein Src (V-SRC), partial

Catalog Number: CSB-EP323598ATH
Article Name: Recombinant Avian sarcoma virus Tyrosine-protein kinase transforming protein Src (V-SRC), partial
Biozol Catalog Number: CSB-EP323598ATH
Supplier Catalog Number: CSB-EP323598ATH
Alternative Catalog Number: CSB-EP323598ATH-1, CSB-EP323598ATH-100, CSB-EP323598ATH-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: pp60v-src
Molecular Weight: 36.0 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P15054
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 267-520aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGEMGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKDPEERPTFEYLQAFLEDYF
Application Notes: Research Areas: Others