Recombinant Woodchuck hepatitis B virus Protein X (X), partial

Catalog Number: CSB-EP323774WAW1
Article Name: Recombinant Woodchuck hepatitis B virus Protein X (X), partial
Biozol Catalog Number: CSB-EP323774WAW1
Supplier Catalog Number: CSB-EP323774WAW1
Alternative Catalog Number: CSB-EP323774WAW1-1, CSB-EP323774WAW1-100, CSB-EP323774WAW1-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: HBx,Peptide X,pX
Molecular Weight: 12.1 kDa
Tag: N-terminal 10xHis-tagged
UniProt: P17401
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-60aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAARLCCHLDSARDVLLLRPFGPQSSGPSFPRPAAGSAASSASSPSPSDESDLPLGRLPA
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.