Recombinant Escherichia coli Cysteine--tRNA ligase (cysS)

Catalog Number: CSB-EP325167ENV
Article Name: Recombinant Escherichia coli Cysteine--tRNA ligase (cysS)
Biozol Catalog Number: CSB-EP325167ENV
Supplier Catalog Number: CSB-EP325167ENV
Alternative Catalog Number: CSB-EP325167ENV-1, CSB-EP325167ENV-100, CSB-EP325167ENV-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Cysteinyl-tRNA synthetase
Molecular Weight: 59.1 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P21888
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.127.
Source: E.coli
Expression System: 1-461aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MLKIFNTLTRQKEEFKPIHAGEVGMYVCGITVYDLCHIGHGRTFVAFDVVARYLRFLGYKLKYVRNITDIDDKIIKRANENGESFVAMVDRMIAEMHKDFDALNILRPDMEPRATHHIAEIIELTEQLIAKGHAYVADNGDVMFDVPTDPTYGVLSRQDLDQLQAGARVDVVDDKRNPMDFVLWKMSKEGEPSWPSPWGAGRPGWHIECSAMNCKQLGNHFDIHGGGSDLMFPHHENEIAQSTCAHDGQYVNYWM
Application Notes: Research Areas: Others