Recombinant Mouse Kallikrein 1-related peptidase b5 (Klk1b5)
Catalog Number:
CSB-EP325792MO
- Images (0)
| Article Name: | Recombinant Mouse Kallikrein 1-related peptidase b5 (Klk1b5) |
| Biozol Catalog Number: | CSB-EP325792MO |
| Supplier Catalog Number: | CSB-EP325792MO |
| Alternative Catalog Number: | CSB-EP325792MO-1, CSB-EP325792MO-100, CSB-EP325792MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (Glandular kallikrein K5)(mGK-5)(Tissue kallikrein-5) |
| Molecular Weight: | 39.1 kDa |
| Tag: | N-terminal 6xHis-SUMO-tagged |
| UniProt: | P15945 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 25-261aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | IFGGFNCEKNSQPWQVAVYRFTKYQCGGVLLNANWVLTAAHCHNDKYQVWLGKNNFFEDEPSAQHRLVSKAIPHPDFNMSLLNEHTPQPEDDYSNDLMLLRLKKPADITDVVKPIDLPTEEPKLGSTCLASGWGSITPVIYEPADDLQCVNFKLLPNEDCVKAHIEKVTDVMLCAGDMDGGKDTCMGDSGGPLICDGVLHGITSWGPSPCGKPNVPGIYTKLIKFNSWIKDTIAKNA |
Product Guarantee and Expert Support
