Recombinant Xanthomonas campestris pv. translucens Ice nucleation protein (inaX), partial

Catalog Number: CSB-EP325961XAJ
Article Name: Recombinant Xanthomonas campestris pv. translucens Ice nucleation protein (inaX), partial
Biozol Catalog Number: CSB-EP325961XAJ
Supplier Catalog Number: CSB-EP325961XAJ
Alternative Catalog Number: CSB-EP325961XAJ-1, CSB-EP325961XAJ-100, CSB-EP325961XAJ-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: /
Molecular Weight: 22.3 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P18127
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1412-1567aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AGDRSKLIAGADSTQTAGDRSKLLAGRNSYLTAGDRSKLTAGDDSTLMAGDRSKLTAGKNSVLTAGANSRLIGSLGSTLSGGENSTLIFRCWDGERYTNLVVRTGEQGVESDIPYQVDDEGNLVGKADDDLVLDYDPGMILDGQCSPGTGEELRDV