Recombinant Human herpesvirus 6B Envelope glycoprotein B (gB), partial

Catalog Number: CSB-EP327525HKA
Article Name: Recombinant Human herpesvirus 6B Envelope glycoprotein B (gB), partial
Biozol Catalog Number: CSB-EP327525HKA
Supplier Catalog Number: CSB-EP327525HKA
Alternative Catalog Number: CSB-EP327525HKA-1, CSB-EP327525HKA-100, CSB-EP327525HKA-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: gB
Molecular Weight: 51.1 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
UniProt: P36320
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 20-399aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: IYCDSDDYIRAGYNHKYPFRICSIAKGTDLMRFDRDISCSPYKSNAKMSEGFFIIYKTNIETYTFPVRTYKNELTFPTSYRDVGVVYFLDRTVMGLAMPVYEANLVNSRAQCYSAVAIKRPDGTVFSAYHEDNNKNETLELFPLNFKSVTNKRFITTKEPYFARGPLWLYSTSTSLNCIVTEATAKAKYPFSYFALTTGEIVEGSPFFDGSNGKHFAEPLEKLTILENYTMIEDLMNGMNGATTLVRKIAFLEKG
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.