Recombinant Saccharomyces cerevisiae Autophagy-related protein 8 (ATG8)

Catalog Number: CSB-EP327793SVG
Article Name: Recombinant Saccharomyces cerevisiae Autophagy-related protein 8 (ATG8)
Biozol Catalog Number: CSB-EP327793SVG
Supplier Catalog Number: CSB-EP327793SVG
Alternative Catalog Number: CSB-EP327793SVG-1, CSB-EP327793SVG-100, CSB-EP327793SVG-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Autophagy-related ubiquitin-like modifier ATG8,Cytoplasm to vacuole targeting protein 5
Molecular Weight: 20.4 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P38182
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-116aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MKSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFG
Application Notes: Research Areas: Others. Endotoxin: Not test