Recombinant Hepatitis C virus genotype 1a Genome polyprotein, partial

Product Overview

• Article Name: Recombinant Hepatitis C virus genotype 1a Genome polyprotein, partial
• Biozol Catalog Number: CSB-EP333180HFD
• Supplier Catalog Number: CSB-EP333180HFD
• Alternative Catalog Number: CSB-EP333180HFD-1, CSB-EP333180HFD-100, CSB-EP333180HFD-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide
• Alternative Names: Genome polyprotein [Cleaved into: Core protein p21, Capsid protein C, p21), Core protein p19, Envelope glycoprotein E1, gp32, gp35), Envelope glycoprotein E2, NS1, gp68, gp70), p7, Protease NS2-3, p23, EC 3.4.22.-), Serine protease NS3, EC 3.4.21.98, EC 3.6.1.15, EC 3.6.4.13, Hepacivirin, NS3P, p70), Non-structural protein 4A, NS4A, p8), Non-structural protein 4B, NS4B, p27), Non-structural protein 5A, NS5A, p56), RNA-directed RNA polymerase, EC 2.7.7.48, NS5B, p68)]

Product Properties

• Molecular Weight: 30.7 kDa
• Tag: N-terminal 6xHis-SUMO-tagged
• UniProt: P26664
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Expression System: 192-325aa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: YQVRNSTGLYHVTNDCPNSSIVYEAADAILHTPGCVPCVREGNASRCWVAMTPTVATRDGKLPATQLRRHIDLLVGSATLCSALYVGDLCGSVFLVGQLFTFSPRRHWTTQGCNCSIYPGHITGHRMAWDMMMN

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.