Recombinant Human HLA class II histocompatibility antigen, DM beta chain (HLA-DMB),partial

Catalog Number: CSB-EP333326HUC7
Article Name: Recombinant Human HLA class II histocompatibility antigen, DM beta chain (HLA-DMB),partial
Biozol Catalog Number: CSB-EP333326HUC7
Supplier Catalog Number: CSB-EP333326HUc7
Alternative Catalog Number: CSB-EP333326HUC7-1, CSB-EP333326HUC7-100, CSB-EP333326HUC7-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: MHC class II antigen DMB,Really interesting new gene 7 protein
Molecular Weight: 29.3 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P28068
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.190.
Source: E.coli
Expression System: 19-218aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPGLSPMQTLK
Application Notes: Research Areas: Immunology