Recombinant Human adenovirus B serotype 3 Hexon protein (L3), partial

Catalog Number: CSB-EP334192HIG
Article Name: Recombinant Human adenovirus B serotype 3 Hexon protein (L3), partial
Biozol Catalog Number: CSB-EP334192HIG
Supplier Catalog Number: CSB-EP334192HIG
Alternative Catalog Number: CSB-EP334192HIG-1, CSB-EP334192HIG-100, CSB-EP334192HIG-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Protein II
Molecular Weight: 33.7 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
UniProt: P36849
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 625-853aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MLRNDTNDQSFNDYLSAANMLYPIPANATNIPISIPSRNWAAFRGWSFTRLKTKETPSLGSGFDPYFVYSGSIPYLDGTFYLNHTFKKVAIMFDSSVSWPGNDRLLSPNEFEIKRTVDGEGYNVAQCNMTKDWFLVQMLANYNIGYQGFYIPEGYKDRMYSFFRNFQPMSRQVVDEVNYTDYKAVTLPYQHNNSGFVGYLAPTMRQGEPYPANYPYPLIGTTAVKSVTQ
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.