Recombinant Saccharomyces cerevisiae Lipid-anchored plasma membrane protein CPP1 (CPP1)

Catalog Number: CSB-EP334389SVG
Article Name: Recombinant Saccharomyces cerevisiae Lipid-anchored plasma membrane protein CPP1 (CPP1)
Biozol Catalog Number: CSB-EP334389SVG
Supplier Catalog Number: CSB-EP334389SVG
Alternative Catalog Number: CSB-EP334389SVG-1, CSB-EP334389SVG-100, CSB-EP334389SVG-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: C-terminally palmitoylated protein CPP1,Cysteine-rich protein CPP1
Molecular Weight: 21.4 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P38216
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.226.
Source: E.coli
Expression System: 2-128aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SANDYYGGTAGEKSQYSRPSNPPPSSAHQNKTQERGYPPQQQQQYYQQQQQHPGYYNQQGYNQQGYNQQGYNQQGYNQQGYNQQGYNQQGHQQPVYVQQQPPQRGNEGCLAACLAALCICCTMDMLF
Application Notes: Research Areas: Others