Recombinant Sulfolobus solfataricus DNA-binding protein 7d (sso7d)

Catalog Number: CSB-EP334566FPM
Article Name: Recombinant Sulfolobus solfataricus DNA-binding protein 7d (sso7d)
Biozol Catalog Number: CSB-EP334566FPM
Supplier Catalog Number: CSB-EP334566FPM
Alternative Catalog Number: CSB-EP334566FPM-1, CSB-EP334566FPM-100, CSB-EP334566FPM-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: 7KDA DNA-binding protein dSso7d
Molecular Weight: 23.1 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: P39476
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 2-64aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.