Recombinant Bovine Beta-defensin 3 (DEFB3)

Catalog Number: CSB-EP338443BO
Article Name: Recombinant Bovine Beta-defensin 3 (DEFB3)
Biozol Catalog Number: CSB-EP338443BO
Supplier Catalog Number: CSB-EP338443BO
Alternative Catalog Number: CSB-EP338443BO-1, CSB-EP338443BO-100, CSB-EP338443BO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: BNBD-3,BNDB-3
Molecular Weight: 11.7 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P46161
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.85.
Source: E.coli
Expression System: 16-57aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QGVRNHVTCRINRGFCVPIRCPGRTRQIGTCFGPRIKCCRSW
Application Notes: Research Areas: Immunology