Recombinant Bovine Beta-defensin 6 (DEFB6)

Catalog Number: CSB-EP338445BOC7
Article Name: Recombinant Bovine Beta-defensin 6 (DEFB6)
Biozol Catalog Number: CSB-EP338445BOC7
Supplier Catalog Number: CSB-EP338445BOc7
Alternative Catalog Number: CSB-EP338445BOC7-1, CSB-EP338445BOC7-100, CSB-EP338445BOC7-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: BNBD-6,BNDB-6
Molecular Weight: 11.7 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P46164
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.228.
Source: E.coli
Expression System: 1-42aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QGVRNHVTCRIYGGFCVPIRCPGRTRQIGTCFGRPVKCCRRW
Application Notes: Research Areas: Others