Recombinant Geobacillus stearothermophilus Neopullulanase (nplT), partial

Catalog Number: CSB-EP340031GFM
Article Name: Recombinant Geobacillus stearothermophilus Neopullulanase (nplT), partial
Biozol Catalog Number: CSB-EP340031GFM
Supplier Catalog Number: CSB-EP340031GFM
Alternative Catalog Number: CSB-EP340031GFM-1, CSB-EP340031GFM-100, CSB-EP340031GFM-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 57.7 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P38940
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.260.
Source: E.coli
Expression System: 118-551aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: PFLHRVDLFEAPDWVKDTVWYQIFPERFANGNPSISPEGSRPWGSEDPTPTSFFGGDLQGIIDHLDYLVDLGITGIYLTPIFRSPSNHKYDTADYFEVDPHFGDKETLKTLIDRCHEKGIRVMLDAVFNHCGYEFAPFQDVWKNGESSKYKDWFHIHEFPLQTEPRPNYDTFRFVPQMPKLNTANPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHEFWREFRQEVKALKPDVYILGEIWHDAMPWLRGDQFD
Application Notes: Research Areas: Others