Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal)
Catalog Number:
CSB-EP340792LNYE1
- Images (0)
| Article Name: | Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal) |
| Biozol Catalog Number: | CSB-EP340792LNYE1 |
| Supplier Catalog Number: | CSB-EP340792LNYe1 |
| Alternative Catalog Number: | CSB-EP340792LNYE1-1, CSB-EP340792LNYE1-100, CSB-EP340792LNYE1-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (PAL)(19 kDa surface antigen)(PPL) |
| Molecular Weight: | 17.0 kDa |
| Tag: | Tag-Free |
| UniProt: | P26493 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 22-176aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | CSKTPGSADGGAAVGDGDATAQGLGQMTHFAGQEPGESYTTQAPHNQLYLFAYDDSTLASKYLPSVNAQAEYLKTHPGARVMIAGHTDERGSREYNVALGERRADTVAEILRMAGVSRQQIRVVSYGKERPANYGHDEASHAQNRRVEFIYEATR |
Product Guarantee and Expert Support
