Recombinant Amaranthus caudatus Antimicrobial peptide 2
Catalog Number:
CSB-EP340863AIH
- Images (0)
| Article Name: | Recombinant Amaranthus caudatus Antimicrobial peptide 2 |
| Biozol Catalog Number: | CSB-EP340863AIH |
| Supplier Catalog Number: | CSB-EP340863AIH |
| Alternative Catalog Number: | CSB-EP340863AIH-1, CSB-EP340863AIH-100, CSB-EP340863AIH-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (AMP2)(AMP1) |
| Molecular Weight: | 18.5 kDa |
| Tag: | N-terminal 6xHis-KSI-tagged |
| UniProt: | P27275 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 26-55aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | VGECVRGRCPSGMCCSQFGYCGKGPKYCGR |
Product Guarantee and Expert Support
