Recombinant Escherichia coli Transketolase 1 (tktA)

Catalog Number: CSB-EP340865ENV
Article Name: Recombinant Escherichia coli Transketolase 1 (tktA)
Biozol Catalog Number: CSB-EP340865ENV
Supplier Catalog Number: CSB-EP340865ENV
Alternative Catalog Number: CSB-EP340865ENV-1, CSB-EP340865ENV-100, CSB-EP340865ENV-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: tktA, tkt, b2935, JW5478, Transketolase 1, TK 1, EC 2.2.1.1
Molecular Weight: 88.2 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: P27302
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-663aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSSRKELANAIRALSMDAVQKAKSGHPGAPMGMADIAEVLWRDFLKHNPQNPSWADRDRFVLSNGHGSMLIYSLLHLTGYDLPMEELKNFRQLHSKTPGHPEVGYTAGVETTTGPLGQGIANAVGMAIAEKTLAAQFNRPGHDIVDHYTYAFMGDGCMMEGISHEVCSLAGTLKLGKLIAFYDDNGISIDGHVEGWFTDDTAMRFEAYGWHVIRDIDGHDAASIKRAVEEARAVTDKPSLLMCKTIIGFGSPNKA
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.