Recombinant Human Peptidyl-prolyl cis-trans isomerase A (PPIA)

Catalog Number: CSB-EP351810HU
Article Name: Recombinant Human Peptidyl-prolyl cis-trans isomerase A (PPIA)
Biozol Catalog Number: CSB-EP351810HU
Supplier Catalog Number: CSB-EP351810HU
Alternative Catalog Number: CSB-EP351810HU-1, CSB-EP351810HU-100, CSB-EP351810HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Cyclophilin ACyclosporin A-binding proteinRotamase A
Molecular Weight: 23.0 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
UniProt: P62937
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-165aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.