Recombinant Human Peptidyl-prolyl cis-trans isomerase A (PPIA)
Catalog Number:
CSB-EP351810HU1E1
- Images (0)
| Article Name: | Recombinant Human Peptidyl-prolyl cis-trans isomerase A (PPIA) |
| Biozol Catalog Number: | CSB-EP351810HU1E1 |
| Supplier Catalog Number: | CSB-EP351810HU1e1 |
| Alternative Catalog Number: | CSB-EP351810HU1E1-1, CSB-EP351810HU1E1-100, CSB-EP351810HU1E1-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Cyclophilin ACyclosporin A-binding proteinRotamase A |
| Molecular Weight: | 17.9 kDa |
| Tag: | Tag-Free |
| UniProt: | P62937 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 2-165aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | VNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE |
Product Guarantee and Expert Support
