Recombinant Glycine max Glycinin G1 (GY1), partial

Catalog Number: CSB-EP356358GGV
Article Name: Recombinant Glycine max Glycinin G1 (GY1), partial
Biozol Catalog Number: CSB-EP356358GGV
Supplier Catalog Number: CSB-EP356358GGV
Alternative Catalog Number: CSB-EP356358GGV-1, CSB-EP356358GGV-100, CSB-EP356358GGV-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 26.9 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P04776
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.100.
Source: E.coli
Expression System: 311-490aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQESQ
Application Notes: Research Areas: Others