Recombinant Escherichia coli Phenylalanine--tRNA ligase alpha subunit (pheS)

Catalog Number: CSB-EP357348ENV
Article Name: Recombinant Escherichia coli Phenylalanine--tRNA ligase alpha subunit (pheS)
Biozol Catalog Number: CSB-EP357348ENV
Supplier Catalog Number: CSB-EP357348ENV
Alternative Catalog Number: CSB-EP357348ENV-1, CSB-EP357348ENV-100, CSB-EP357348ENV-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Phenylalanyl-tRNA synthetase alpha subunit
Molecular Weight: 43.7 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P08312
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.129.
Source: E.coli
Expression System: 1-327aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSHLAELVASAKAAISQASDVAALDNVRVEYLGKKGHLTLQMTTLRELPPEERPAAGAVINEAKEQVQQALNARKAELESAALNARLAAETIDVSLPGRRIENGGLHPVTRTIDRIESFFGELGFTVATGPEIEDDYHNFDALNIPGHHPARADHDTFWFDTTRLLRTQTSGVQIRTMKAQQPPIRIIAPGRVYRNDYDQTHTPMFHQMEGLIVDTNISFTNLKGTLHDFLRNFFEEDLQIRFRPSYFPFTEPSA
Application Notes: Research Areas: Others