Recombinant Salmonella typhimurium Chaperone protein skp (skp)

Catalog Number: CSB-EP358140SXB
Article Name: Recombinant Salmonella typhimurium Chaperone protein skp (skp)
Biozol Catalog Number: CSB-EP358140SXB
Supplier Catalog Number: CSB-EP358140SXB
Alternative Catalog Number: CSB-EP358140SXB-1, CSB-EP358140SXB-100, CSB-EP358140SXB-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Cationic 16 kDa outer membrane protein,Outer membrane protein OmpH
Molecular Weight: 22.8 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P0A1Z2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.92.
Source: E.coli
Expression System: 21-161aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ADKIAIVNMGNLFQQVAQKTGVSNTLENEFKGRAAELQKMETDLQSKMQRLQSMKAGSDRTKLEKDVMSQRQTFAQKAQAFEKDRARRSNEERNKLVTRIQTAVKKVANDQSIDLVVDANTVAYNSSDVKDITADVLKQVK
Application Notes: Research Areas: Others