Recombinant Escherichia coli Peptide release factor RF3 (prfC)

Catalog Number: CSB-EP358978ENV
Article Name: Recombinant Escherichia coli Peptide release factor RF3 (prfC)
Biozol Catalog Number: CSB-EP358978ENV
Supplier Catalog Number: CSB-EP358978ENV
Alternative Catalog Number: CSB-EP358978ENV-1, CSB-EP358978ENV-100, CSB-EP358978ENV-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 66.4 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P0A7I4
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.130.
Source: E.coli
Expression System: 2-529aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: TLSPYLQEVAKRRTFAIISHPDAGKTTITEKVLLFGQAIQTAGTVKGRGSNQHAKSDWMEMEKQRGISITTSVMQFPYHDCLVNLLDTPGHEDFSEDTYRTLTAVDCCLMVIDAAKGVEDRTRKLMEVTRLRDTPILTFMNKLDRDIRDPMELLDEVENELKIGCAPITWPIGCGKLFKGVYHLYKDETYLYQSGKGHTIQEVRIVKGLNNPDLDAAVGEDLAQQLRDELELVKGASNEFDKELFLAGEITPVFF
Application Notes: Research Areas: Others