Recombinant Escherichia coli Asparagine--tRNA ligase (asnS)

Catalog Number: CSB-EP359157ENV
Article Name: Recombinant Escherichia coli Asparagine--tRNA ligase (asnS)
Biozol Catalog Number: CSB-EP359157ENV
Supplier Catalog Number: CSB-EP359157ENV
Alternative Catalog Number: CSB-EP359157ENV-1, CSB-EP359157ENV-100, CSB-EP359157ENV-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Asparaginyl-tRNA synthetase
Molecular Weight: 59.4 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P0A8M0
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.131.
Source: E.coli
Expression System: 2-466aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SVVPVADVLQGRVAVDSEVTVRGWVRTRRDSKAGISFLAVYDGSCFDPVQAVINNSLPNYNEDVLRLTTGCSVIVTGKVVASPGQGQQFEIQASKVEVAGWVEDPDTYPMAAKRHSIEYLREVAHLRPRTNLIGAVARVRHTLAQALHRFFNEQGFFWVSTPLITASDTEGAGEMFRVSTLDLENLPRNDQGKVDFDKDFFGKESFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTSRHLAEFWMLEPEVAF
Application Notes: Research Areas: Others