Recombinant Escherichia coli O157:H7 Hydrogenase 3 maturation protease (hycI)

Catalog Number: CSB-EP360175EODB0
Article Name: Recombinant Escherichia coli O157:H7 Hydrogenase 3 maturation protease (hycI)
Biozol Catalog Number: CSB-EP360175EODB0
Supplier Catalog Number: CSB-EP360175EODb0
Alternative Catalog Number: CSB-EP360175EODB0-1, CSB-EP360175EODB0-100, CSB-EP360175EODB0-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: HycI protease
Molecular Weight: 24.5 kDa
Tag: N-terminal 10xHis-tagged
UniProt: P0AEW0
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.231.
Source: E.coli
Expression System: 2-156aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: TDVLLCVGNSMMGDDGAGPLLAEKCAAAPKGNWVVIDGGSAPENDIVAIRELRPTRLLIVDATDMGLNPGEIRIIDPDDIAEMFMMTTHNMPLNYLIDQLKEDIGEVIFLGIQPDIVGFYYPMTQPIKDAVETVYQRLEGWEGNGGFAQLAVEEE
Application Notes: Research Areas: Others