Recombinant Clostridium pasteurianum Rubredoxin, Biotinylated

Catalog Number: CSB-EP360387CMA-B
Article Name: Recombinant Clostridium pasteurianum Rubredoxin, Biotinylated
Biozol Catalog Number: CSB-EP360387CMA-B
Supplier Catalog Number: CSB-EP360387CMA-B
Alternative Catalog Number: CSB-EP360387CMA-B-1, CSB-EP360387CMA-B-100, CSB-EP360387CMA-B-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 53.8 kDa
Tag: N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
UniProt: P00268
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.77.
Source: E.coli
Expression System: 1-54aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE
Application Notes: Research Areas: Others