Recombinant Clostridium pasteurianum Rubredoxin

Catalog Number: CSB-EP360387CMAE0
Article Name: Recombinant Clostridium pasteurianum Rubredoxin
Biozol Catalog Number: CSB-EP360387CMAE0
Supplier Catalog Number: CSB-EP360387CMAe0
Alternative Catalog Number: CSB-EP360387CMAE0-1, CSB-EP360387CMAE0-100, CSB-EP360387CMAE0-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 33.2 kDa
Tag: N-terminal GST-tagged
UniProt: P00268
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.195.
Source: E.coli
Expression System: 1-54aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE
Application Notes: Research Areas: Others