Recombinant Mouse Hemoglobin subunit beta-2 (Hbb-b2)

Catalog Number: CSB-EP360812MOF0
Article Name: Recombinant Mouse Hemoglobin subunit beta-2 (Hbb-b2)
Biozol Catalog Number: CSB-EP360812MOF0
Supplier Catalog Number: CSB-EP360812MOf0
Alternative Catalog Number: CSB-EP360812MOF0-1, CSB-EP360812MOF0-100, CSB-EP360812MOF0-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Beta-2-globin,Hemoglobin beta-2 chain,Hemoglobin beta-minor chain
Molecular Weight: 47.3 kDa
Tag: C-terminal GST-tagged
UniProt: P02089
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.156.
Source: E.coli
Expression System: 2-147aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: VHLTDAEKSAVSCLWAKVNPDEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNPKVKAHGKKVITAFNEGLKNLDNLKGTFASLSELHCDKLHVDPENFRLLGNAIVIVLGHHLGKDFTPAAQAAFQKVVAGVATALAHKYH
Application Notes: Research Areas: Others