Recombinant Influenza A virus Polymerase basic protein 2 (PB2), partial

Catalog Number: CSB-EP361051IFZ
Article Name: Recombinant Influenza A virus Polymerase basic protein 2 (PB2), partial
Biozol Catalog Number: CSB-EP361051IFZ
Supplier Catalog Number: CSB-EP361051IFZ
Alternative Catalog Number: CSB-EP361051IFZ-1, CSB-EP361051IFZ-100, CSB-EP361051IFZ-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: RNA-directed RNA polymerase subunit P3
Molecular Weight: 25.8 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P03428
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 318-484aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: RISSSFSFGGFTFKRTSGSSVKREEEVLTGNLQTLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWGVEPIDNVMGMIGILPDMTPSIEMSMRGVRISKMG
Application Notes: Research Areas: Others. Endotoxin: Not test