Recombinant Influenza A virus RNA-directed RNA polymerase catalytic subunit (PB1), partial

Catalog Number: CSB-EP361052IFZ
Article Name: Recombinant Influenza A virus RNA-directed RNA polymerase catalytic subunit (PB1), partial
Biozol Catalog Number: CSB-EP361052IFZ
Supplier Catalog Number: CSB-EP361052IFZ
Alternative Catalog Number: CSB-EP361052IFZ-1, CSB-EP361052IFZ-100, CSB-EP361052IFZ-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Polymerase basic protein 1,RNA-directed RNA polymerase subunit P1
Molecular Weight: 30.4 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P03431
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 283-486aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ANVVRKMMTNSQDTELSFTITGDNTKWNENQNPRMFLAMITYMTRNQPEWFRNVLSIAPIMFSNKMARLGKGYMFESKSMKLRTQIPAEMLASIDLKYFNDSTRKKIEKIRPLLIEGTASLSPGMMMGMFNMLSTVLGVSILNLGQKRYTKTTYWWDGLQSSDDFALIVNAPNHEGIQAGVDRFYRTCKLLGINMSKKKSYINR
Application Notes: Research Areas: Others. Endotoxin: Not test