Recombinant Pseudomonas phage PP7 Capsid protein

Catalog Number: CSB-EP361109PUW
Article Name: Recombinant Pseudomonas phage PP7 Capsid protein
Biozol Catalog Number: CSB-EP361109PUW
Supplier Catalog Number: CSB-EP361109PUW
Alternative Catalog Number: CSB-EP361109PUW-1, CSB-EP361109PUW-100, CSB-EP361109PUW-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Coat protein
Molecular Weight: 20.6 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P03630
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 2-127aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SKTIVLSVGEATRTLTEIQSTADRQIFEEKVGPLVGRLRLTASLRQNGAKTAYRVNLKLDQADVVDCSTSVCGELPKVRYTQVWSHDVTIVANSTEASRKSLYDLTKSLVATSQVEDLVVNLVPLG
Application Notes: Research Areas: Others