Recombinant Escherichia coli Type-1 fimbrial protein, A chain (fimA)

Catalog Number: CSB-EP361210ENV
Article Name: Recombinant Escherichia coli Type-1 fimbrial protein, A chain (fimA)
Biozol Catalog Number: CSB-EP361210ENV
Supplier Catalog Number: CSB-EP361210ENV
Alternative Catalog Number: CSB-EP361210ENV-1, CSB-EP361210ENV-100, CSB-EP361210ENV-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Type-1A pilin
Molecular Weight: 31.8 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: P04128
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 24-182aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.