Recombinant Escherichia coli Serine--tRNA ligase (serS)

Catalog Number: CSB-EP364183ENV
Article Name: Recombinant Escherichia coli Serine--tRNA ligase (serS)
Biozol Catalog Number: CSB-EP364183ENV
Supplier Catalog Number: CSB-EP364183ENV
Alternative Catalog Number: CSB-EP364183ENV-1, CSB-EP364183ENV-100, CSB-EP364183ENV-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Seryl-tRNA synthetase,Seryl-tRNA(Ser/Sec) synthetase
Molecular Weight: 55.3 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P0A8L1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.118.
Source: E.coli
Expression System: 1-430aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MLDPNLLRNEPDAVAEKLARRGFKLDVDKLGALEERRKVLQVKTENLQAERNSRSKSIGQAKARGEDIEPLRLEVNKLGEELDAAKAELDALQAEIRDIALTIPNLPADEVPVGKDENDNVEVSRWGTPREFDFEVRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQFMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADTSNYALIPTAEVPLTNLVRGEIIDEDD
Application Notes: Research Areas: Others