Recombinant Escherichia coli Isoleucine--tRNA ligase (ileS)

Catalog Number: CSB-EP365495ENV(A4)
Article Name: Recombinant Escherichia coli Isoleucine--tRNA ligase (ileS)
Biozol Catalog Number: CSB-EP365495ENV(A4)
Supplier Catalog Number: CSB-EP365495ENV(A4)
Alternative Catalog Number: CSB-EP365495ENV(A4)-1, CSB-EP365495ENV(A4)-100, CSB-EP365495ENV(A4)-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Isoleucyl-tRNA synthetase
Molecular Weight: 111.1 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P00956
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 2-938aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SDYKSTLNLPETGFPMRGDLAKREPGMLARWTDDDLYGIIRAAKKGKKTFILHDGPPYANGSIHIGHSVNKILKDIIVKSKGLSGYDSPYVPGWDCHGLPIELKVEQEYGKPGEKFTAAEFRAKCREYAATQVDGQRKDFIRLGVLGDWSHPYLTMDFKTEANIIRALGKIIGNGHLHKGAKPVHWCVDCRSALAEAEVEYYDKTSPSIDVAFQAVDQDALKAKFAVSNVNGPISLVIWTTTPWTLPANRAISIA
Application Notes: Research Areas: Others