Recombinant Escherichia coli Methionine--tRNA ligase (metG)

Catalog Number: CSB-EP365496ENV
Article Name: Recombinant Escherichia coli Methionine--tRNA ligase (metG)
Biozol Catalog Number: CSB-EP365496ENV
Supplier Catalog Number: CSB-EP365496ENV
Alternative Catalog Number: CSB-EP365496ENV-1, CSB-EP365496ENV-100, CSB-EP365496ENV-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Methionyl-tRNA synthetase
Molecular Weight: 83.0 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P00959
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.120.
Source: E.coli
Expression System: 2-677aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: TQVAKKILVTCALPYANGSIHLGHMLEHIQADVWVRYQRMRGHEVNFICADDAHGTPIMLKAQQLGITPEQMIGEMSQEHQTDFAGFNISYDNYHSTHSEENRQLSELIYSRLKENGFIKNRTISQLYDPEKGMFLPDRFVKGTCPKCKSPDQYGDNCEVCGATYSPTELIEPKSVVSGATPVMRDSEHFFFDLPSFSEMLQAWTRSGALQEQVANKMQEWFESGLQQWDISRDAPYFGFEIPNAPGKYFYVWLD
Application Notes: Research Areas: Others